Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein Staphylococcal enterotoxin A, SEA [50220] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries) |
Domain d1i4hb1: 1i4h B:8-120 [25153] Other proteins in same PDB: d1i4ha2, d1i4hb2 complexed with zn; mutant |
PDB Entry: 1i4h (more details), 2.9 Å
SCOPe Domain Sequences for d1i4hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4hb1 b.40.2.2 (B:8-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
Timeline for d1i4hb1: