Lineage for d1i4hb1 (1i4h B:8-120)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 13930Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 13931Species Staphylococcus aureus [TaxId:1280] [50221] (4 PDB entries)
  8. Domain d1i4hb1: 1i4h B:8-120 [25153]
    Other proteins in same PDB: d1i4ha2, d1i4hb2

Details for d1i4hb1

PDB Entry: 1i4h (more details), 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a

SCOP Domain Sequences for d1i4hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4hb1 b.40.2.2 (B:8-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1i4hb1 are not available.

Timeline for d1i4hb1:

Domains from same chain:
(mouse over for more information)
d1i4hb2
Domains from other chains:
(mouse over for more information)
d1i4ha1, d1i4ha2