SCOPe 2.05: Domain d4doua1: 4dou A:108-244

Lineage for d4doua1 (4dou A:108-244)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)

8. Domain d4doua1: 4dou A:108-244 [251529]
   automated match to d1c3ha_
   complexed with ca, edo, gol, na

Details for d4doua1

PDB Entry: 4dou, 2 Å

PDB Description: crystal structure of a single-chain trimer of human adiponectin globular domain

PDB Compounds: (A:) Adiponectin

SCOPe Domain Sequences for d4doua1:

Sequence, based on SEQRES records:

>d4doua1 b.22.1.0 (A:108-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayvyrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvy
mkdvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygegernglyad
ndndstftgfllyhdtn

Sequence, based on observed residues (ATOM records):

>d4doua1 b.22.1.0 (A:108-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayvyrsafsvgletyvtmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkd
vkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvyernglyadndndst
ftgfllyhdtn

Timeline for d4doua1:

• d4doua1 first appeared in SCOPe 2.04
  
• d4doua1 appears in SCOPe 2.06
  
• d4doua1 appears in the current release, SCOPe 2.08