SCOPe 2.04: Domain d4doib_: 4doi B:

Lineage for d4doib_ (4doi B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.36: Chalcone isomerase [54625] (1 superfamily)
   beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567

4. Superfamily d.36.1: Chalcone isomerase [54626] (2 families)
   automatically mapped to Pfam PF02431

5. Family d.36.1.0: automated matches [254325] (1 protein)
   not a true family

6. Protein automated matches [254745] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256237] (1 PDB entry)

8. Domain d4doib_: 4doi B: [251527]
   automated match to d1eyqa_
   complexed with no3

Details for d4doib_

PDB Entry: 4doi, 1.55 Å

PDB Description: Crystal structure of Arabidopsis thaliana chalcone isomerase At3g55120 (AtCHI)

PDB Compounds: (B:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d4doib_:

Sequence; same for both SEQRES and ATOM records:

>d4doib_ d.36.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
avtklhvdsvtfvpsvkspassnplflggagvrgldiqgkfviftvigvylegnavpsls
vkwkgktteeltesipffreivtgafekfikvtmklpltgqqysekvtencvaiwkqlgl
ytdceakavekfleifkeetfppgssilfalsptgsltvafskddsipetgiavienkll
aeavlesiigkngvspgtrlsvaerlsqlmmkn

Timeline for d4doib_:

• d4doib_ is new in SCOPe 2.04-stable
  
• d4doib_ appears in SCOPe 2.05
  
• d4doib_ appears in the current release, SCOPe 2.08