Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.36: Chalcone isomerase [54625] (1 superfamily) beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567 |
Superfamily d.36.1: Chalcone isomerase [54626] (2 families) automatically mapped to Pfam PF02431 |
Family d.36.1.0: automated matches [254325] (1 protein) not a true family |
Protein automated matches [254745] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256237] (1 PDB entry) |
Domain d4doib_: 4doi B: [251527] automated match to d1eyqa_ complexed with no3 |
PDB Entry: 4doi (more details), 1.55 Å
SCOPe Domain Sequences for d4doib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4doib_ d.36.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} avtklhvdsvtfvpsvkspassnplflggagvrgldiqgkfviftvigvylegnavpsls vkwkgktteeltesipffreivtgafekfikvtmklpltgqqysekvtencvaiwkqlgl ytdceakavekfleifkeetfppgssilfalsptgsltvafskddsipetgiavienkll aeavlesiigkngvspgtrlsvaerlsqlmmkn
Timeline for d4doib_: