Lineage for d4doib_ (4doi B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511324Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2511325Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2511347Family d.36.1.0: automated matches [254325] (1 protein)
    not a true family
  6. 2511348Protein automated matches [254745] (2 species)
    not a true protein
  7. 2511349Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256237] (1 PDB entry)
  8. 2511351Domain d4doib_: 4doi B: [251527]
    automated match to d1eyqa_
    complexed with no3

Details for d4doib_

PDB Entry: 4doi (more details), 1.55 Å

PDB Description: Crystal structure of Arabidopsis thaliana chalcone isomerase At3g55120 (AtCHI)
PDB Compounds: (B:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d4doib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4doib_ d.36.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
avtklhvdsvtfvpsvkspassnplflggagvrgldiqgkfviftvigvylegnavpsls
vkwkgktteeltesipffreivtgafekfikvtmklpltgqqysekvtencvaiwkqlgl
ytdceakavekfleifkeetfppgssilfalsptgsltvafskddsipetgiavienkll
aeavlesiigkngvspgtrlsvaerlsqlmmkn

SCOPe Domain Coordinates for d4doib_:

Click to download the PDB-style file with coordinates for d4doib_.
(The format of our PDB-style files is described here.)

Timeline for d4doib_: