Lineage for d4doda_ (4dod A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498424Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1498441Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 1498442Protein CelA cellulase [48214] (2 species)
  7. 1498443Species Caldicellulosiruptor bescii [TaxId:31899] [256382] (2 PDB entries)
  8. 1498445Domain d4doda_: 4dod A: [251524]
    automated match to d1ia6a_
    complexed with ca, dio, edo, gol, so4

Details for d4doda_

PDB Entry: 4dod (more details), 1.7 Å

PDB Description: The structure of Cbescii CelA GH9 module
PDB Compounds: (A:) 1,4-beta-glucanase

SCOPe Domain Sequences for d4doda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4doda_ a.102.1.2 (A:) CelA cellulase {Caldicellulosiruptor bescii [TaxId: 31899]}
asgsfnygealqkaimfyefqmsgklpnwvrnnwrgdsalkdgqdngldltggwfdagdh
vkfnlpmsytgtmlswavyeykdafvksgqlehilnqiewvndyfvkchpskyvyyyqvg
dgskdhawwgpaevmqmerpsfkvtqsspgstvvaetaaslaaasivlkdrnptkaatyl
qhakelyefaevtksdagytaangyynswsgfydelswaavwlylatndstyltkaesyv
qnwpkisgsntidykwahcwddvhngaalllakitgkdiykqiieshldywttgyngeri
kytpkglawldqwgslryatttaflafvysdwvgcpstkkeiyrkfgesqidyalgsagr
sfvvgfgtnppkrphhrtahsswadsqsipsyhrhtlygalvggpgsddsytddisnyvn
nevacdynagfvgalakmyqlyggnpipdfkaie

SCOPe Domain Coordinates for d4doda_:

Click to download the PDB-style file with coordinates for d4doda_.
(The format of our PDB-style files is described here.)

Timeline for d4doda_: