Lineage for d4doda1 (4dod A:24-475)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004077Protein CelA cellulase [48214] (2 species)
  7. 2004078Species Caldicellulosiruptor bescii [TaxId:31899] [256382] (2 PDB entries)
  8. 2004080Domain d4doda1: 4dod A:24-475 [251524]
    Other proteins in same PDB: d4doda2
    automated match to d1ia6a_
    complexed with ca, dio, edo, gol, so4

Details for d4doda1

PDB Entry: 4dod (more details), 1.7 Å

PDB Description: The structure of Cbescii CelA GH9 module
PDB Compounds: (A:) 1,4-beta-glucanase

SCOPe Domain Sequences for d4doda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4doda1 a.102.1.2 (A:24-475) CelA cellulase {Caldicellulosiruptor bescii [TaxId: 31899]}
gsfnygealqkaimfyefqmsgklpnwvrnnwrgdsalkdgqdngldltggwfdagdhvk
fnlpmsytgtmlswavyeykdafvksgqlehilnqiewvndyfvkchpskyvyyyqvgdg
skdhawwgpaevmqmerpsfkvtqsspgstvvaetaaslaaasivlkdrnptkaatylqh
akelyefaevtksdagytaangyynswsgfydelswaavwlylatndstyltkaesyvqn
wpkisgsntidykwahcwddvhngaalllakitgkdiykqiieshldywttgyngeriky
tpkglawldqwgslryatttaflafvysdwvgcpstkkeiyrkfgesqidyalgsagrsf
vvgfgtnppkrphhrtahsswadsqsipsyhrhtlygalvggpgsddsytddisnyvnne
vacdynagfvgalakmyqlyggnpipdfkaie

SCOPe Domain Coordinates for d4doda1:

Click to download the PDB-style file with coordinates for d4doda1.
(The format of our PDB-style files is described here.)

Timeline for d4doda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4doda2