Lineage for d4dnpa_ (4dnp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902652Species Petunia hybrida [TaxId:4102] [256236] (7 PDB entries)
  8. 2902663Domain d4dnpa_: 4dnp A: [251511]
    automated match to d1woma_
    complexed with dtv, gol

Details for d4dnpa_

PDB Entry: 4dnp (more details), 2.15 Å

PDB Description: crystal structure of dad2
PDB Compounds: (A:) dad2

SCOPe Domain Sequences for d4dnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dnpa_ c.69.1.0 (A:) automated matches {Petunia hybrida [TaxId: 4102]}
qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
fdfrryttldpyvddllhildalgidccayvghsvsamigilasirrpelfskliligas
prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
ieghlphlsaptllaqelrrals

SCOPe Domain Coordinates for d4dnpa_:

Click to download the PDB-style file with coordinates for d4dnpa_.
(The format of our PDB-style files is described here.)

Timeline for d4dnpa_: