SCOPe 2.08: Domain d4dnfc1: 4dnf C:25-319

Lineage for d4dnfc1 (4dnf C:25-319)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [255906] (33 PDB entries)

8. Domain d4dnfc1: 4dnf C:25-319 [251505]
   Other proteins in same PDB: d4dnfa2, d4dnfb2, d4dnfc2, d4dnfd2
   automated match to d4io0a_
   complexed with ebh; mutant

Details for d4dnfc1

PDB Entry: 4dnf, 1.8 Å

PDB Description: crystal structure of the cftr inhibitory factor cif with the e153q mutation adducted with the epibromohydrin hydrolysis intermediate

PDB Compounds: (C:) Putative hydrolase

SCOPe Domain Sequences for d4dnfc1:

Sequence; same for both SEQRES and ATOM records:

>d4dnfc1 c.69.1.0 (C:25-319) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgr

Timeline for d4dnfc1:

• d4dnfc1 first appeared in SCOPe 2.04, called d4dnfc_
  
• d4dnfc1 appears in SCOPe 2.07