Lineage for d4dmca_ (4dmc A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1618025Species Pseudomonas aeruginosa [TaxId:208963] [255906] (13 PDB entries)
  8. 1618050Domain d4dmca_: 4dmc A: [251485]
    automated match to d4io0a_
    mutant

Details for d4dmca_

PDB Entry: 4dmc (more details), 1.66 Å

PDB Description: crystal structure of the cftr inhibitory factor cif with the e153q mutation
PDB Compounds: (A:) Putative hydrolase

SCOPe Domain Sequences for d4dmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dmca_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrh

SCOPe Domain Coordinates for d4dmca_:

Click to download the PDB-style file with coordinates for d4dmca_.
(The format of our PDB-style files is described here.)

Timeline for d4dmca_: