SCOPe 2.06: Domain d1i4ga1: 1i4g A:10-120

Lineage for d1i4ga1 (1i4g A:10-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)

8. Domain d1i4ga1: 1i4g A:10-120 [25148]
   Other proteins in same PDB: d1i4ga2, d1i4gb2
   complexed with so4, zn; mutant

Details for d1i4ga1

PDB Entry: 1i4g, 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

PDB Compounds: (A:) enterotoxin type a

SCOPe Domain Sequences for d1i4ga1:

Sequence; same for both SEQRES and ATOM records:

>d1i4ga1 b.40.2.2 (A:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d1i4ga1:

• d1i4ga1 first appeared (with stable ids) in SCOP 1.55
  
• d1i4ga1 appears in SCOPe 2.05
  
• d1i4ga1 appears in SCOPe 2.07
  
• d1i4ga1 appears in the current release, SCOPe 2.08