Lineage for d1i4ga1 (1i4g A:10-120)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559499Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 559500Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)
  8. 559503Domain d1i4ga1: 1i4g A:10-120 [25148]
    Other proteins in same PDB: d1i4ga2, d1i4gb2

Details for d1i4ga1

PDB Entry: 1i4g (more details), 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

SCOP Domain Sequences for d1i4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ga1 b.40.2.2 (A:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1i4ga1:

Click to download the PDB-style file with coordinates for d1i4ga1.
(The format of our PDB-style files is described here.)

Timeline for d1i4ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4ga2