Lineage for d4dkta2 (4dkt A:113-293)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1526139Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family) (S)
    automatically mapped to Pfam PF08527
  5. 1526140Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 1526141Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 1526142Species Human (Homo sapiens) [TaxId:9606] [110086] (12 PDB entries)
    Uniprot Q9UM07
  8. 1526151Domain d4dkta2: 4dkt A:113-293 [251475]
    Other proteins in same PDB: d4dkta1, d4dkta3
    automated match to d2dexx1
    complexed with ca, edo, so4

Details for d4dkta2

PDB Entry: 4dkt (more details), 2.98 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with n-acetyl-l-threonyl-l-alpha-aspartyl-n5-[(1e)-2- fluoroethanimidoyl]-l-ornithinamide
PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d4dkta2:

Sequence, based on SEQRES records: (download)

>d4dkta2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d4dkta2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptkdqrtwtwgpcgqgaillvncdrdnlessamdceddevldse
dlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpg
gkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d4dkta2:

Click to download the PDB-style file with coordinates for d4dkta2.
(The format of our PDB-style files is described here.)

Timeline for d4dkta2: