SCOPe 2.05: Domain d4djtb_: 4djt B:

Lineage for d4djtb_ (4djt B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Encephalitozoon cuniculi [TaxId:284813] [256235] (1 PDB entry)

8. Domain d4djtb_: 4djt B: [251466]
   automated match to d1qbkc_
   complexed with gdp, mg, na

Details for d4djtb_

PDB Entry: 4djt, 1.8 Å

PDB Description: Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+

PDB Compounds: (B:) GTP-binding nuclear protein GSP1

SCOPe Domain Sequences for d4djtb_:

Sequence, based on SEQRES records:

>d4djtb_ c.37.1.0 (B:) automated matches {Encephalitozoon cuniculi [TaxId: 284813]}
gpgsmerreltykicligdggvgkttyinrvldgrfeknynatvgavnhpvtflddqgnv
ikfnvwdtagqekkavlkdvyyigasgailffdvtsritcqnlarwvkefqavvgneapi
vvcankidiknrqkiskklvmevlkgknyeyfeisaktahnfglpflhlariftgrpdli
fvsnvnleptevnydyhspeeskyidymeq

Sequence, based on observed residues (ATOM records):

>d4djtb_ c.37.1.0 (B:) automated matches {Encephalitozoon cuniculi [TaxId: 284813]}
gpgsmerreltykicligdggvgkttyinrvldgrfeknynatvgavnhpvtflddqgnv
ikfnvwdtagqekkavlkdvyyigasgailffdvtsritcqnlarwvkefqavvgneapi
vvcankidikkklvmevlkgknyeyfeisaktahnfglpflhlariftgrpdlifvsnvn
leptevnydyhspeeskyidymeq

Timeline for d4djtb_:

• d4djtb_ first appeared in SCOPe 2.04
  
• d4djtb_ is called d4djtb1 in SCOPe 2.06
  
• d4djtb_ appears in the current release, SCOPe 2.08, called d4djtb1