Lineage for d4djta_ (4djt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114086Species Encephalitozoon cuniculi [TaxId:284813] [256235] (1 PDB entry)
  8. 2114087Domain d4djta_: 4djt A: [251465]
    Other proteins in same PDB: d4djtb2
    automated match to d1qbkc_
    complexed with gdp, mg, na

Details for d4djta_

PDB Entry: 4djt (more details), 1.8 Å

PDB Description: Crystal structure of a nuclear GTP-binding protein from Encephalitozoon cuniculi bound to GDP-Mg2+
PDB Compounds: (A:) GTP-binding nuclear protein GSP1

SCOPe Domain Sequences for d4djta_:

Sequence, based on SEQRES records: (download)

>d4djta_ c.37.1.0 (A:) automated matches {Encephalitozoon cuniculi [TaxId: 284813]}
ltykicligdggvgkttyinrvldgrfeknynatvgavnhpvtflddqgnvikfnvwdta
gqekkavlkdvyyigasgailffdvtsritcqnlarwvkefqavvgneapivvcankidi
knrqkiskklvmevlkgknyeyfeisaktahnfglpflhlariftgrpdlifvsnvnlep
tevnydyhsp

Sequence, based on observed residues (ATOM records): (download)

>d4djta_ c.37.1.0 (A:) automated matches {Encephalitozoon cuniculi [TaxId: 284813]}
ltykicligdggvgkttyinrvldgrfeknynatvgavnhpvtflddqgnvikfnvwdta
gqekkavlkdvyyigasgailffdvtsritcqnlarwvkefqavvgneapivvcankidi
kiskklvmevlkgknyeyfeisaktahnfglpflhlariftgrpdlifvsnvnleptevn
ydyhsp

SCOPe Domain Coordinates for d4djta_:

Click to download the PDB-style file with coordinates for d4djta_.
(The format of our PDB-style files is described here.)

Timeline for d4djta_: