Lineage for d4djfb_ (4djf B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575887Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1575982Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 1576005Protein automated matches [190620] (2 species)
    not a true protein
  7. 1576010Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries)
  8. 1576018Domain d4djfb_: 4djf B: [251463]
    automated match to d2e7fa_
    complexed with c2f, ca, cob, sf4

Details for d4djfb_

PDB Entry: 4djf (more details), 3.03 Å

PDB Description: Crystal structure of folate-bound corrinoid iron-sulfur protein (CFeSP) in complex with its methyltransferase (MeTr), co-crystallized with folate and Ti(III) citrate reductant
PDB Compounds: (B:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d4djfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djfb_ c.1.21.2 (B:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d4djfb_:

Click to download the PDB-style file with coordinates for d4djfb_.
(The format of our PDB-style files is described here.)

Timeline for d4djfb_: