Lineage for d4djfa_ (4djf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840322Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2840464Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 2840487Protein automated matches [190620] (2 species)
    not a true protein
  7. 2840492Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries)
  8. 2840499Domain d4djfa_: 4djf A: [251462]
    automated match to d2e7fa_
    complexed with c2f, ca, cob, sf4

Details for d4djfa_

PDB Entry: 4djf (more details), 3.03 Å

PDB Description: Crystal structure of folate-bound corrinoid iron-sulfur protein (CFeSP) in complex with its methyltransferase (MeTr), co-crystallized with folate and Ti(III) citrate reductant
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d4djfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djfa_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d4djfa_:

Click to download the PDB-style file with coordinates for d4djfa_.
(The format of our PDB-style files is described here.)

Timeline for d4djfa_: