Lineage for d4dj9a2 (4dj9 A:129-254)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700113Protein Vinculin [47224] (2 species)
  7. 2700127Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2700130Domain d4dj9a2: 4dj9 A:129-254 [251461]
    automated match to d3rf3b2

Details for d4dj9a2

PDB Entry: 4dj9 (more details), 2.25 Å

PDB Description: Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (VBS50, residues 2078-2099)
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d4dj9a2:

Sequence, based on SEQRES records: (download)

>d4dj9a2 a.24.9.1 (A:129-254) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswd

Sequence, based on observed residues (ATOM records): (download)

>d4dj9a2 a.24.9.1 (A:129-254) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttqgieealknrnftvekmsaeineiirvlqltsw
d

SCOPe Domain Coordinates for d4dj9a2:

Click to download the PDB-style file with coordinates for d4dj9a2.
(The format of our PDB-style files is described here.)

Timeline for d4dj9a2: