![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein Vinculin [47224] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries) Uniprot P18206 1-257 |
![]() | Domain d4dj9a1: 4dj9 A:3-128 [251460] automated match to d3rf3b1 |
PDB Entry: 4dj9 (more details), 2.25 Å
SCOPe Domain Sequences for d4dj9a1:
Sequence, based on SEQRES records: (download)
>d4dj9a1 a.24.9.1 (A:3-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]} vfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgketv qttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsdl lltfde
>d4dj9a1 a.24.9.1 (A:3-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]} vfhtrtiesilepvaqqishlvimheegkaipdltapvaavqaavsnlvrvgketvqtte dqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsdllltf de
Timeline for d4dj9a1: