SCOPe 2.06: Domain d4dhzf_: 4dhz F:

Lineage for d4dhzf_ (4dhz F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (7 PDB entries)

8. Domain d4dhzf_: 4dhz F: [251459]
   Other proteins in same PDB: d4dhzb_, d4dhze_
   automated match to d3w31b_

Details for d4dhzf_

PDB Entry: 4dhz, 3.11 Å

PDB Description: the structure of h/ceotub1-ubiquitin aldehyde-ubc13~ub

PDB Compounds: (F:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhzf_:

Sequence; same for both SEQRES and ATOM records:

>d4dhzf_ d.20.1.1 (F:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn

Timeline for d4dhzf_:

• d4dhzf_ first appeared in SCOPe 2.04
  
• d4dhzf_ appears in SCOPe 2.05
  
• d4dhzf_ appears in SCOPe 2.07
  
• d4dhzf_ appears in the current release, SCOPe 2.08