Lineage for d4dhzf_ (4dhz F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939083Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. 2939120Domain d4dhzf_: 4dhz F: [251459]
    Other proteins in same PDB: d4dhzb_, d4dhze_
    automated match to d3w31b_

Details for d4dhzf_

PDB Entry: 4dhz (more details), 3.11 Å

PDB Description: the structure of h/ceotub1-ubiquitin aldehyde-ubc13~ub
PDB Compounds: (F:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhzf_ d.20.1.1 (F:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn

SCOPe Domain Coordinates for d4dhzf_:

Click to download the PDB-style file with coordinates for d4dhzf_.
(The format of our PDB-style files is described here.)

Timeline for d4dhzf_: