| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
| Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries) |
| Domain d4dhzf_: 4dhz F: [251459] Other proteins in same PDB: d4dhzb_, d4dhze_ automated match to d3w31b_ |
PDB Entry: 4dhz (more details), 3.11 Å
SCOPe Domain Sequences for d4dhzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhzf_ d.20.1.1 (F:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn
Timeline for d4dhzf_: