Lineage for d4dhgc1 (4dhg C:1-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948615Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries)
  8. 2948618Domain d4dhgc1: 4dhg C:1-133 [251453]
    Other proteins in same PDB: d4dhga2, d4dhga3, d4dhgb2, d4dhgb3, d4dhgc2, d4dhgc3, d4dhgd2, d4dhgd3
    automated match to d3vc6a1
    complexed with gol, iod, po4, unl

Details for d4dhgc1

PDB Entry: 4dhg (more details), 1.9 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4dhgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhgc1 d.54.1.0 (C:1-133) automated matches {Thermobispora bispora [TaxId: 469371]}
mlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvra
aaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrvktvdrvfaafevacldiq
gkaagrpvadllg

SCOPe Domain Coordinates for d4dhgc1:

Click to download the PDB-style file with coordinates for d4dhgc1.
(The format of our PDB-style files is described here.)

Timeline for d4dhgc1: