Lineage for d4dhgb2 (4dhg B:134-419)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446420Species Thermobispora bispora [TaxId:469371] [233843] (3 PDB entries)
  8. 2446424Domain d4dhgb2: 4dhg B:134-419 [251452]
    Other proteins in same PDB: d4dhga1, d4dhga3, d4dhgb1, d4dhgb3, d4dhgc1, d4dhgc3, d4dhgd1, d4dhgd3
    automated match to d3vc6a2
    complexed with gol, iod, po4, unl

Details for d4dhgb2

PDB Entry: 4dhg (more details), 1.9 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4dhgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhgb2 c.1.11.0 (B:134-419) automated matches {Thermobispora bispora [TaxId: 469371]}
gkvrdavpysaylfykwaghpgkpedrfgpaldpdgivaqarlligeygfrsiklkggvf
ppeqeaeaiqalrdafpglplrldpnaawtvetsirvgraldgvleyledptpgidgmar
vaaevpmplatnmcvvtpehlpaaverrpigvllidhhywgglvrsahiatlcatfgiel
smhsnshlgislaamthlaaatpaithacdthtpwqdgqdvvapgalrfvdgavpvpdgp
glgveldrdalavmheqyercgirtrddegymrsfdpsfstrrgfw

SCOPe Domain Coordinates for d4dhgb2:

Click to download the PDB-style file with coordinates for d4dhgb2.
(The format of our PDB-style files is described here.)

Timeline for d4dhgb2: