| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Thermobispora bispora [TaxId:469371] [233843] (3 PDB entries) |
| Domain d4dhgb2: 4dhg B:134-419 [251452] Other proteins in same PDB: d4dhga1, d4dhga3, d4dhgb1, d4dhgb3, d4dhgc1, d4dhgc3, d4dhgd1, d4dhgd3 automated match to d3vc6a2 complexed with gol, iod, po4, unl |
PDB Entry: 4dhg (more details), 1.9 Å
SCOPe Domain Sequences for d4dhgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhgb2 c.1.11.0 (B:134-419) automated matches {Thermobispora bispora [TaxId: 469371]}
gkvrdavpysaylfykwaghpgkpedrfgpaldpdgivaqarlligeygfrsiklkggvf
ppeqeaeaiqalrdafpglplrldpnaawtvetsirvgraldgvleyledptpgidgmar
vaaevpmplatnmcvvtpehlpaaverrpigvllidhhywgglvrsahiatlcatfgiel
smhsnshlgislaamthlaaatpaithacdthtpwqdgqdvvapgalrfvdgavpvpdgp
glgveldrdalavmheqyercgirtrddegymrsfdpsfstrrgfw
Timeline for d4dhgb2: