SCOPe 2.05: Domain d4dhga2: 4dhg A:134-419

Lineage for d4dhga2 (4dhg A:134-419)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Thermobispora bispora [TaxId:469371] [233843] (3 PDB entries)

8. Domain d4dhga2: 4dhg A:134-419 [251450]
   Other proteins in same PDB: d4dhga1, d4dhgb1, d4dhgc1, d4dhgd1
   automated match to d3vc6a2
   complexed with gol, iod, po4, unl

Details for d4dhga2

PDB Entry: 4dhg, 1.9 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4dhga2:

Sequence; same for both SEQRES and ATOM records:

>d4dhga2 c.1.11.0 (A:134-419) automated matches {Thermobispora bispora [TaxId: 469371]}
gkvrdavpysaylfykwaghpgkpedrfgpaldpdgivaqarlligeygfrsiklkggvf
ppeqeaeaiqalrdafpglplrldpnaawtvetsirvgraldgvleyledptpgidgmar
vaaevpmplatnmcvvtpehlpaaverrpigvllidhhywgglvrsahiatlcatfgiel
smhsnshlgislaamthlaaatpaithacdthtpwqdgqdvvapgalrfvdgavpvpdgp
glgveldrdalavmheqyercgirtrddegymrsfdpsfstrrgfw

Timeline for d4dhga2:

• d4dhga2 first appeared in SCOPe 2.04
  
• d4dhga2 appears in SCOPe 2.06
  
• d4dhga2 appears in the current release, SCOPe 2.08