Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Pertussis toxin S5 subunit [50217] (1 species) |
Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries) |
Domain d1ptol_: 1pto L: [25145] Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_ complexed with gal, sia |
PDB Entry: 1pto (more details), 3.5 Å
SCOP Domain Sequences for d1ptol_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptol_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis [TaxId: 520]} lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai sayalksrialtvedspypgtpgdllelqicplngyce
Timeline for d1ptol_: