Lineage for d1ptol_ (1pto L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228828Protein Pertussis toxin S5 subunit [50217] (1 species)
  7. 228829Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)
  8. 228835Domain d1ptol_: 1pto L: [25145]
    Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_
    complexed with gal, sia

Details for d1ptol_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptol_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

SCOP Domain Coordinates for d1ptol_:

Click to download the PDB-style file with coordinates for d1ptol_.
(The format of our PDB-style files is described here.)

Timeline for d1ptol_: