Lineage for d4dgpa2 (4dgp A:111-218)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919174Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)
  8. 1919188Domain d4dgpa2: 4dgp A:111-218 [251444]
    Other proteins in same PDB: d4dgpa3
    automated match to d2shpa3

Details for d4dgpa2

PDB Entry: 4dgp (more details), 2.3 Å

PDB Description: The wild-type Src homology 2 (SH2)-domain containing protein tyrosine phosphatase-2 (SHP2)
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4dgpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgpa2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d4dgpa2:

Click to download the PDB-style file with coordinates for d4dgpa2.
(The format of our PDB-style files is described here.)

Timeline for d4dgpa2: