SCOPe 2.08: Domain d4dglb_: 4dgl B:

Lineage for d4dglb_ (4dgl B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family)
   automatically mapped to Pfam PF01214

5. Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
   contains alpha-helices in the N- and C-terminal extensions (linkers?)

6. Protein Casein kinase II beta subunit [57800] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)

8. Domain d4dglb_: 4dgl B: [251440]
   Other proteins in same PDB: d4dglc_, d4dgld_
   automated match to d1jwhd_
   complexed with zn

Details for d4dglb_

PDB Entry: 4dgl, 3 Å

PDB Description: Crystal Structure of the CK2 Tetrameric Holoenzyme

PDB Compounds: (B:) Casein kinase II subunit beta

SCOPe Domain Sequences for d4dglb_:

Sequence; same for both SEQRES and ATOM records:

>d4dglb_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeelednp
nqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsd
ipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvpr
lygfkihpmayqlqlqaasnf

Timeline for d4dglb_:

• d4dglb_ first appeared in SCOPe 2.04
  
• d4dglb_ appears in SCOPe 2.07