Lineage for d4dgla_ (4dgl A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641184Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
    automatically mapped to Pfam PF01214
  5. 2641185Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 2641186Protein Casein kinase II beta subunit [57800] (3 species)
  7. 2641196Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)
  8. 2641201Domain d4dgla_: 4dgl A: [251439]
    Other proteins in same PDB: d4dglc_, d4dgld_
    automated match to d1jwhd_
    complexed with zn

Details for d4dgla_

PDB Entry: 4dgl (more details), 3 Å

PDB Description: Crystal Structure of the CK2 Tetrameric Holoenzyme
PDB Compounds: (A:) Casein kinase II subunit beta

SCOPe Domain Sequences for d4dgla_:

Sequence, based on SEQRES records: (download)

>d4dgla_ g.41.4.1 (A:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
swiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeelednpn
qsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdi
pgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprl
ygfkihpmayqlqlqaasnfkspvktir

Sequence, based on observed residues (ATOM records): (download)

>d4dgla_ g.41.4.1 (A:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
swiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlnpnqsdlieqa
aemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeamvkl
ycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfkihpm
ayqlqlqaasnfkspvktir

SCOPe Domain Coordinates for d4dgla_:

Click to download the PDB-style file with coordinates for d4dgla_.
(The format of our PDB-style files is described here.)

Timeline for d4dgla_: