Lineage for d4depb3 (4dep B:208-310)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759042Domain d4depb3: 4dep B:208-310 [251432]
    Other proteins in same PDB: d4depa_, d4depd1, d4depd2
    automated match to d1iray3
    complexed with nag

Details for d4depb3

PDB Entry: 4dep (more details), 3.1 Å

PDB Description: structure of the il-1b signaling complex
PDB Compounds: (B:) Interleukin-1 receptor type 1

SCOPe Domain Sequences for d4depb3:

Sequence, based on SEQRES records: (download)

>d4depb3 b.1.1.0 (B:208-310) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysvenp
ankrrstlitvlniseiesrfykhpftcfaknthgidaayiql

Sequence, based on observed residues (ATOM records): (download)

>d4depb3 b.1.1.0 (B:208-310) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpvivspanetmevdlqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysvenpan
krrstlitvlniseiesrfykhpftcfaknthgidaayiql

SCOPe Domain Coordinates for d4depb3:

Click to download the PDB-style file with coordinates for d4depb3.
(The format of our PDB-style files is described here.)

Timeline for d4depb3: