Lineage for d1bcpl_ (1bcp L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228828Protein Pertussis toxin S5 subunit [50217] (1 species)
  7. 228829Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)
  8. 228833Domain d1bcpl_: 1bcp L: [25143]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_
    complexed with atp

Details for d1bcpl_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpl_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

SCOP Domain Coordinates for d1bcpl_:

Click to download the PDB-style file with coordinates for d1bcpl_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpl_: