Lineage for d4dejj1 (4dej J:8-88)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879919Species Idiomarina loihiensis [TaxId:283942] [256231] (1 PDB entry)
  8. 2879929Domain d4dejj1: 4dej J:8-88 [251423]
    Other proteins in same PDB: d4deja2, d4deja3, d4dejb2, d4dejb3, d4dejc2, d4dejc3, d4dejd2, d4dejd3, d4deje2, d4deje3, d4dejf2, d4dejg2, d4dejg3, d4dejh2, d4dejh3, d4deji2, d4deji3, d4dejj2, d4dejj3, d4dejk2, d4dejk3, d4dejl2
    automated match to d4hoja1

Details for d4dejj1

PDB Entry: 4dej (more details), 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR
PDB Compounds: (J:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4dejj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dejj1 c.47.1.0 (J:8-88) automated matches {Idiomarina loihiensis [TaxId: 283942]}
rsvmtlysgkddlkshqvrlvlaekgvgveityvtdestpedllqlnpypeakptlvdre
lvlynaqiimeylderfphpp

SCOPe Domain Coordinates for d4dejj1:

Click to download the PDB-style file with coordinates for d4dejj1.
(The format of our PDB-style files is described here.)

Timeline for d4dejj1: