Lineage for d4deji2 (4dej I:89-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714044Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry)
  8. 2714053Domain d4deji2: 4dej I:89-207 [251422]
    Other proteins in same PDB: d4deja1, d4deja3, d4dejb1, d4dejb3, d4dejc1, d4dejc3, d4dejd1, d4dejd3, d4deje1, d4deje3, d4dejf1, d4dejg1, d4dejg3, d4dejh1, d4dejh3, d4deji1, d4deji3, d4dejj1, d4dejj3, d4dejk1, d4dejk3, d4dejl1
    automated match to d4hoja2

Details for d4deji2

PDB Entry: 4dej (more details), 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR
PDB Compounds: (I:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4deji2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4deji2 a.45.1.0 (I:89-207) automated matches {Idiomarina loihiensis [TaxId: 283942]}
lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms
eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekelarn

SCOPe Domain Coordinates for d4deji2:

Click to download the PDB-style file with coordinates for d4deji2.
(The format of our PDB-style files is described here.)

Timeline for d4deji2: