Lineage for d4dejf2 (4dej F:89-205)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736612Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry)
  8. 1736618Domain d4dejf2: 4dej F:89-205 [251416]
    Other proteins in same PDB: d4deja1, d4dejb1, d4dejc1, d4dejd1, d4deje1, d4dejf1, d4dejg1, d4dejh1, d4deji1, d4dejj1, d4dejk1, d4dejl1
    automated match to d4hoja2

Details for d4dejf2

PDB Entry: 4dej (more details), 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR
PDB Compounds: (F:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4dejf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dejf2 a.45.1.0 (F:89-205) automated matches {Idiomarina loihiensis [TaxId: 283942]}
lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms
eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekela

SCOPe Domain Coordinates for d4dejf2:

Click to download the PDB-style file with coordinates for d4dejf2.
(The format of our PDB-style files is described here.)

Timeline for d4dejf2: