![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Idiomarina loihiensis [TaxId:283942] [256231] (1 PDB entry) |
![]() | Domain d4deje1: 4dej E:9-88 [251413] Other proteins in same PDB: d4deja2, d4deja3, d4dejb2, d4dejb3, d4dejc2, d4dejc3, d4dejd2, d4dejd3, d4deje2, d4deje3, d4dejf2, d4dejg2, d4dejg3, d4dejh2, d4dejh3, d4deji2, d4deji3, d4dejj2, d4dejj3, d4dejk2, d4dejk3, d4dejl2 automated match to d4hoja1 |
PDB Entry: 4dej (more details), 2.9 Å
SCOPe Domain Sequences for d4deje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4deje1 c.47.1.0 (E:9-88) automated matches {Idiomarina loihiensis [TaxId: 283942]} svmtlysgkddlkshqvrlvlaekgvgveityvtdestpedllqlnpypeakptlvdrel vlynaqiimeylderfphpp
Timeline for d4deje1:
![]() Domains from other chains: (mouse over for more information) d4deja1, d4deja2, d4deja3, d4dejb1, d4dejb2, d4dejb3, d4dejc1, d4dejc2, d4dejc3, d4dejd1, d4dejd2, d4dejd3, d4dejf1, d4dejf2, d4dejg1, d4dejg2, d4dejg3, d4dejh1, d4dejh2, d4dejh3, d4deji1, d4deji2, d4deji3, d4dejj1, d4dejj2, d4dejj3, d4dejk1, d4dejk2, d4dejk3, d4dejl1, d4dejl2 |