Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (41 species) not a true protein |
Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry) |
Domain d4dejd2: 4dej D:89-208 [251412] Other proteins in same PDB: d4deja1, d4dejb1, d4dejc1, d4dejd1, d4deje1, d4dejf1, d4dejg1, d4dejh1, d4deji1, d4dejj1, d4dejk1, d4dejl1 automated match to d4hoja2 |
PDB Entry: 4dej (more details), 2.9 Å
SCOPe Domain Sequences for d4dejd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dejd2 a.45.1.0 (D:89-208) automated matches {Idiomarina loihiensis [TaxId: 283942]} lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekelarna
Timeline for d4dejd2: