Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Idiomarina loihiensis [TaxId:283942] [256231] (1 PDB entry) |
Domain d4dejd1: 4dej D:6-88 [251411] Other proteins in same PDB: d4deja2, d4deja3, d4dejb2, d4dejb3, d4dejc2, d4dejc3, d4dejd2, d4dejd3, d4deje2, d4deje3, d4dejf2, d4dejg2, d4dejg3, d4dejh2, d4dejh3, d4deji2, d4deji3, d4dejj2, d4dejj3, d4dejk2, d4dejk3, d4dejl2 automated match to d4hoja1 |
PDB Entry: 4dej (more details), 2.9 Å
SCOPe Domain Sequences for d4dejd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dejd1 c.47.1.0 (D:6-88) automated matches {Idiomarina loihiensis [TaxId: 283942]} nkrsvmtlysgkddlkshqvrlvlaekgvgveityvtdestpedllqlnpypeakptlvd relvlynaqiimeylderfphpp
Timeline for d4dejd1:
View in 3D Domains from other chains: (mouse over for more information) d4deja1, d4deja2, d4deja3, d4dejb1, d4dejb2, d4dejb3, d4dejc1, d4dejc2, d4dejc3, d4deje1, d4deje2, d4deje3, d4dejf1, d4dejf2, d4dejg1, d4dejg2, d4dejg3, d4dejh1, d4dejh2, d4dejh3, d4deji1, d4deji2, d4deji3, d4dejj1, d4dejj2, d4dejj3, d4dejk1, d4dejk2, d4dejk3, d4dejl1, d4dejl2 |