| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (133 species) not a true protein |
| Species Idiomarina loihiensis [TaxId:283942] [256231] (1 PDB entry) |
| Domain d4dejd1: 4dej D:6-88 [251411] Other proteins in same PDB: d4deja2, d4dejb2, d4dejc2, d4dejd2, d4deje2, d4dejf2, d4dejg2, d4dejh2, d4deji2, d4dejj2, d4dejk2, d4dejl2 automated match to d4hoja1 |
PDB Entry: 4dej (more details), 2.9 Å
SCOPe Domain Sequences for d4dejd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dejd1 c.47.1.0 (D:6-88) automated matches {Idiomarina loihiensis [TaxId: 283942]}
nkrsvmtlysgkddlkshqvrlvlaekgvgveityvtdestpedllqlnpypeakptlvd
relvlynaqiimeylderfphpp
Timeline for d4dejd1: