SCOPe 2.04: Domain d4dejc2: 4dej C:89-208

Lineage for d4dejc2 (4dej C:89-208)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (41 species)
   not a true protein

7. Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry)

8. Domain d4dejc2: 4dej C:89-208 [251410]
   Other proteins in same PDB: d4deja1, d4dejb1, d4dejc1, d4dejd1, d4deje1, d4dejf1, d4dejg1, d4dejh1, d4deji1, d4dejj1, d4dejk1, d4dejl1
   automated match to d4hoja2

Details for d4dejc2

PDB Entry: 4dej, 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR

PDB Compounds: (C:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4dejc2:

Sequence; same for both SEQRES and ATOM records:

>d4dejc2 a.45.1.0 (C:89-208) automated matches {Idiomarina loihiensis [TaxId: 283942]}
lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms
eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekelarna

Timeline for d4dejc2:

• d4dejc2 is new in SCOPe 2.04-stable
  
• d4dejc2 appears in SCOPe 2.05
  
• d4dejc2 appears in the current release, SCOPe 2.08