SCOPe 2.08: Domain d4dejc2: 4dej C:89-207

Lineage for d4dejc2 (4dej C:89-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry)

8. Domain d4dejc2: 4dej C:89-207 [251410]
   Other proteins in same PDB: d4deja1, d4deja3, d4dejb1, d4dejb3, d4dejc1, d4dejc3, d4dejd1, d4dejd3, d4deje1, d4deje3, d4dejf1, d4dejg1, d4dejg3, d4dejh1, d4dejh3, d4deji1, d4deji3, d4dejj1, d4dejj3, d4dejk1, d4dejk3, d4dejl1
   automated match to d4hoja2

Details for d4dejc2

PDB Entry: 4dej, 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR

PDB Compounds: (C:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4dejc2:

Sequence; same for both SEQRES and ATOM records:

>d4dejc2 a.45.1.0 (C:89-207) automated matches {Idiomarina loihiensis [TaxId: 283942]}
lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms
eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekelarn

Timeline for d4dejc2:

• d4dejc2 first appeared in SCOPe 2.04
  
• d4dejc2 appears in SCOPe 2.07