SCOPe 2.04: Domain d4dejc1: 4dej C:8-88

Lineage for d4dejc1 (4dej C:8-88)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Idiomarina loihiensis [TaxId:283942] [256231] (1 PDB entry)

8. Domain d4dejc1: 4dej C:8-88 [251409]
   Other proteins in same PDB: d4deja2, d4dejb2, d4dejc2, d4dejd2, d4deje2, d4dejf2, d4dejg2, d4dejh2, d4deji2, d4dejj2, d4dejk2, d4dejl2
   automated match to d4hoja1

Details for d4dejc1

PDB Entry: 4dej, 2.9 Å

PDB Description: Crystal structure of glutathione transferase-like protein IL0419 (Target EFI-501089) from Idiomarina loihiensis L2TR

PDB Compounds: (C:) Glutathione S-transferase related protein

SCOPe Domain Sequences for d4dejc1:

Sequence; same for both SEQRES and ATOM records:

>d4dejc1 c.47.1.0 (C:8-88) automated matches {Idiomarina loihiensis [TaxId: 283942]}
rsvmtlysgkddlkshqvrlvlaekgvgveityvtdestpedllqlnpypeakptlvdre
lvlynaqiimeylderfphpp

Timeline for d4dejc1:

• d4dejc1 is new in SCOPe 2.04-stable
  
• d4dejc1 appears in SCOPe 2.05
  
• d4dejc1 appears in the current release, SCOPe 2.08