Lineage for d4dcnd_ (4dcn D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738028Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins)
    automatically mapped to Pfam PF06456
  6. 2738039Protein automated matches [254744] (1 species)
    not a true protein
  7. 2738040Species Human (Homo sapiens) [TaxId:9606] [256230] (1 PDB entry)
  8. 2738042Domain d4dcnd_: 4dcn D: [251401]
    Other proteins in same PDB: d4dcna_, d4dcnb_
    automated match to d1i4da_
    complexed with gnp, mg

Details for d4dcnd_

PDB Entry: 4dcn (more details), 3.01 Å

PDB Description: Crystal Structure Analysis of the Arfaptin2 BAR domain in Complex with ARL1
PDB Compounds: (D:) Arfaptin-2

SCOPe Domain Sequences for d4dcnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dcnd_ a.238.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelq
eefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayr
tdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqll
lfhnavsayfagnqkq

SCOPe Domain Coordinates for d4dcnd_:

Click to download the PDB-style file with coordinates for d4dcnd_.
(The format of our PDB-style files is described here.)

Timeline for d4dcnd_: