![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins) automatically mapped to Pfam PF06456 |
![]() | Protein automated matches [254744] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256230] (1 PDB entry) |
![]() | Domain d4dcnc_: 4dcn C: [251400] Other proteins in same PDB: d4dcna_, d4dcnb_ automated match to d1i4da_ complexed with gnp, mg |
PDB Entry: 4dcn (more details), 3.01 Å
SCOPe Domain Sequences for d4dcnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dcnc_ a.238.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql llfhnavsayfag
Timeline for d4dcnc_: