SCOPe 2.06: Domain d1prtf_: 1prt F:

Lineage for d1prtf_ (1prt F:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Pertussis toxin S5 subunit [50217] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)

8. Domain d1prtf_: 1prt F: [25140]
   Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtd_, d1prte_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtj_, d1prtk_

Details for d1prtf_

PDB Entry: 1prt, 2.9 Å

PDB Description: the crystal structure of pertussis toxin

PDB Compounds: (F:) pertussis toxin (subunit s5)

SCOPe Domain Sequences for d1prtf_:

Sequence; same for both SEQRES and ATOM records:

>d1prtf_ b.40.2.1 (F:) Pertussis toxin S5 subunit {Bordetella pertussis [TaxId: 520]}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

Timeline for d1prtf_:

• d1prtf_ first appeared (with stable ids) in SCOP 1.55
  
• d1prtf_ appears in SCOPe 2.05
  
• d1prtf_ appears in SCOPe 2.07
  
• d1prtf_ appears in the current release, SCOPe 2.08