SCOPe 2.05: Domain d4dcnb_: 4dcn B:

Lineage for d4dcnb_ (4dcn B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142220] (2 PDB entries)

8. Domain d4dcnb_: 4dcn B: [251399]
   Other proteins in same PDB: d4dcnc_, d4dcnd_
   automated match to d1mr3f_
   complexed with gnp, mg

Details for d4dcnb_

PDB Entry: 4dcn, 3.01 Å

PDB Description: Crystal Structure Analysis of the Arfaptin2 BAR domain in Complex with ARL1

PDB Compounds: (B:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d4dcnb_:

Sequence; same for both SEQRES and ATOM records:

>d4dcnb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens) [TaxId: 9606]}
tremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsi
rpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqam
tssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks

Timeline for d4dcnb_:

• d4dcnb_ first appeared in SCOPe 2.04
  
• d4dcnb_ appears in SCOPe 2.06
  
• d4dcnb_ appears in the current release, SCOPe 2.08