Lineage for d4d8gc1 (4d8g C:1-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703625Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 2703636Domain d4d8gc1: 4d8g C:1-318 [251387]
    Other proteins in same PDB: d4d8ga2, d4d8gb2, d4d8gc2, d4d8gd2
    automated match to d2ania_
    complexed with fe, mn

Details for d4d8gc1

PDB Entry: 4d8g (more details), 1.75 Å

PDB Description: chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 2 - low mn)
PDB Compounds: (C:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4d8gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8gc1 a.25.1.2 (C:1-318) automated matches {Chlamydia trachomatis [TaxId: 813]}
mqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgk
dielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafee
avhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqe
fvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidling
ikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrl
eriglkpiyhtknpfpwm

SCOPe Domain Coordinates for d4d8gc1:

Click to download the PDB-style file with coordinates for d4d8gc1.
(The format of our PDB-style files is described here.)

Timeline for d4d8gc1: