Lineage for d4d8fb1 (4d8f B:1-324)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316867Protein automated matches [190435] (12 species)
    not a true protein
  7. 2316884Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 2316899Domain d4d8fb1: 4d8f B:1-324 [251382]
    Other proteins in same PDB: d4d8fa2, d4d8fb2, d4d8fc2, d4d8fd2
    automated match to d2ania_
    complexed with acy, fe, mn

Details for d4d8fb1

PDB Entry: 4d8f (more details), 2.2 Å

PDB Description: chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 1 - high mn)
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4d8fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8fb1 a.25.1.2 (B:1-324) automated matches {Chlamydia trachomatis [TaxId: 813]}
mqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgk
dielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafee
avhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqe
fvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidling
ikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrl
eriglkpiyhtknpfpwmsetidl

SCOPe Domain Coordinates for d4d8fb1:

Click to download the PDB-style file with coordinates for d4d8fb1.
(The format of our PDB-style files is described here.)

Timeline for d4d8fb1: