Lineage for d4d86a2 (4d86 A:1015-1191)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856004Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 1856005Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 1856124Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 1856125Protein automated matches [190146] (9 species)
    not a true protein
  7. 1856137Species Human (Homo sapiens) [TaxId:9606] [256134] (2 PDB entries)
  8. 1856139Domain d4d86a2: 4d86 A:1015-1191 [251380]
    automated match to d2dx6a_
    complexed with adp

Details for d4d86a2

PDB Entry: 4d86 (more details), 2 Å

PDB Description: human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphate
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 14

SCOPe Domain Sequences for d4d86a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d86a2 c.50.1.0 (A:1015-1191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmllvkegvqnaktdvvvnsvpldlvlsrgplsksllekagpelqeeldtvgqgvavsmg
tvlktsswnldcryvlhvvapewrngstsslkimediirecmeiteslslksiafpaigt
gnlgfpknifaeliisevfkfssknqlktlqevhfllhpsdheniqafsdefarran

SCOPe Domain Coordinates for d4d86a2:

Click to download the PDB-style file with coordinates for d4d86a2.
(The format of our PDB-style files is described here.)

Timeline for d4d86a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d86a1