SCOPe 2.08: Domain d4d86a2: 4d86 A:1015-1191

Lineage for d4d86a2 (4d86 A:1015-1191)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256134] (4 PDB entries)

8. Domain d4d86a2: 4d86 A:1015-1191 [251380]
   automated match to d2dx6a_
   complexed with adp

Details for d4d86a2

PDB Entry: 4d86, 2 Å

PDB Description: human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphate

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 14

SCOPe Domain Sequences for d4d86a2:

Sequence; same for both SEQRES and ATOM records:

>d4d86a2 c.50.1.0 (A:1015-1191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmllvkegvqnaktdvvvnsvpldlvlsrgplsksllekagpelqeeldtvgqgvavsmg
tvlktsswnldcryvlhvvapewrngstsslkimediirecmeiteslslksiafpaigt
gnlgfpknifaeliisevfkfssknqlktlqevhfllhpsdheniqafsdefarran

Timeline for d4d86a2:

• d4d86a2 first appeared in SCOPe 2.04
  
• d4d86a2 appears in SCOPe 2.07